Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP157487

SNRP70 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157487 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157487 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157487 Supplier Novus Biologicals Supplier No. NBP157487
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

SNRP70 Polyclonal specifically detects SNRP70 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SNRP70
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P08621
Gene Alias RNPU1ZU170K, RPU1U1AP, small nuclear ribonucleoprotein 70kDa (U1), Snp1, snRNP70, SNRP70U1 small nuclear ribonucleoprotein 70 kDa, U1 snRNP 70 kDa, U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen), U1AP1, U1RNP
Gene Symbols SNRNP70
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen)) The peptide sequence was selected from the N terminal of SNRP70 (NP_003080). Peptide sequence PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 51 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6625
Test Specificity Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Western clawed frog: 100%; Bovine: 100%; Zebrafish: 100%; Xenopus: 100%; Canine: 100%; Rat: 100%; African malaria mosquito: 92%; Yellowfever mosquito: 92%; Mosquito: 92%; Harpegnathos saltator: 92%; Camponotus floridanus: 92%; Brown alga: 92%; Red flour beetle: 92%; Florida lancelet: 92%; Black-legged tick: 92%; Trichoplax reptans: 92%; Fruit fly: 92%; Caenorhabditis elegans: 85%; Caenorhabditis vulgaris: 85%; Eye worm: 85%; Body louse: 85%; Caenorhabditis briggsae: 85%; Filarial nematode worm: 85%; Planarian: 85%; Starlet sea anemone: 85%; Toxoplasma gondii ME49: 84%; Toxoplasma gondii: 84%; Blood fluke: 83%; Moss: 76%; Spikemoss: 76%; Volvox carteri f. nagariensis: 76%; Chlorella variabilis: 76%; Chlamydomonas smithii: 76%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.