SNRPF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15746320UL

Catalog No. NBP15746320

Description

SNRPF Polyclonal specifically detects SNRPF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SNRPF
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P62306
• Gene Symbols: SNRPF
• Immunogen: Synthetic peptides corresponding to SNRPF (small nuclear ribonucleoprotein polypeptide F) The peptide sequence was selected from the N terminal of SNRPF. Peptide sequence MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: PBSCF, Sm protein F, small nuclear ribonucleoprotein polypeptide F, SMF, Sm-Fsmall nuclear ribonucleoprotein F, snRNP-F
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6636
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG