SNRPG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23804525UL

Catalog No. NB436331

Description

SNRPG Polyclonal specifically detects SNRPG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SNRPG
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P62308
• Gene Symbols: SNRPG
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RHVQGILRGFDPFMNLVIDECVEMATSGQQ
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6637
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: MGC117317, PBSCG, small nuclear ribonucleoprotein G, small nuclear ribonucleoprotein polypeptide G, SMG, Sm-GSm protein G, snRNP-G
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.