SNRPN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174239

Catalog No. NBP174239

Description

SNRPN Polyclonal specifically detects SNRPN in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNRPN
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686C0927, DKFZp686M12165, DKFZp761I1912, DKFZp762N022, FLJ39265, HCERN3FLJ33569, MGC29886, Prader-Willi syndrome chromosome region, PWCR, RT-LI, Sm protein D, Sm protein N, small nuclear ribonucleoprotein polypeptide N, small nuclear ribonucleoprotein-associated protein N, Sm-D, sm-N, SmN, SMNFLJ36996, SNRNP-N, SNURF-SNRPN, tissue-specific splicing protein, Tissue-specific-splicing protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P63162
• Gene Symbols: SNRPN
• Immunogen: Synthetic peptides corresponding to the N terminal of SNRPN. Immunizing peptide sequence DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARV.
• Quantity: 100 μL
• Research Discipline: Diabetes Research
• Gene ID (Entrez): 6638
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.