SNX5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158340

Catalog No. NBP158340

Description

SNX5 Polyclonal specifically detects SNX5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNX5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ10931, sorting nexin 5, sorting nexin-5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Xenopus: 92%; Chicken: 92%; Guinea pig: 92%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y5X3
• Gene Symbols: SNX5
• Immunogen: Synthetic peptides corresponding to SNX5(sorting nexin 5) The peptide sequence was selected from the N terminal of SNX5. Peptide sequence FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF.
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 27131
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only