Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNX7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | SNX7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15886220
|
Novus Biologicals
NBP15886220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP158862
|
Novus Biologicals
NBP158862 |
100 μL |
Each for $487.50
|
|
|||||
Description
SNX7 Polyclonal specifically detects SNX7 in Human samples. It is validated for Western Blot.Specifications
| SNX7 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| DKFZp564F052, MGC8717, sorting nexin 7, sorting nexin-7 | |
| SNX7 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UNH6 | |
| 51375 | |
| Synthetic peptides corresponding to SNX7(sorting nexin 7) The peptide sequence was selected from the middle region of SNX7. Peptide sequence LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title