Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNX7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | SNX7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15886220
|
Novus Biologicals
NBP15886220UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP158862
|
Novus Biologicals
NBP158862 |
100 μL |
Each for $482.50
|
|
|||||
Description
SNX7 Polyclonal specifically detects SNX7 in Human samples. It is validated for Western Blot.Specifications
| SNX7 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| DKFZp564F052, MGC8717, sorting nexin 7, sorting nexin-7 | |
| SNX7 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UNH6 | |
| 51375 | |
| Synthetic peptides corresponding to SNX7(sorting nexin 7) The peptide sequence was selected from the middle region of SNX7. Peptide sequence LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title