Sodium Potassium ATPase Alpha 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP288330

Catalog No. NB035952

Description

Sodium Potassium ATPase Alpha 3 Polyclonal specifically detects Sodium Potassium ATPase Alpha 3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Sodium Potassium ATPase Alpha 3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 478
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: alpha 3 polypeptide, ATPase, Na+/K+ transporting, alpha 3 polypeptide, dystonia 12, DYT12, EC 3.6.3, MGC13276, RDP, Sodium pump subunit alpha-3, sodium/potassium-transporting ATPase alpha-3 chain, sodium/potassium-transporting ATPase subunit alpha-3
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human Sodium Potassium ATPase Alpha 3. Peptide sequence: KVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQG The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified