Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SOHLH1 Antibody, Novus Biologicals™

SOHLH1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15676220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15676220 20 μL
NBP156762 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15676220 Supplier Novus Biologicals Supplier No. NBP15676220UL

Description

Rabbit Polyclonal Antibody

SOHLH1 Polyclonal specifically detects SOHLH1 in Human samples. It is validated for Western Blot.

Specifications

Antigen SOHLH1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias bA100C15.3, bHLHe80, C9orf157, NOHLHchromosome 9 open reading frame 157, spermatogenesis and oogenesis specific basic helix-loop-helix 1, spermatogenesis- and oogenesis-specific basic helix-loop-helix-containingprotein 1, TEB2newborn ovary helix loop helix
Gene Symbols SOHLH1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SOHLH1(spermatogenesis and oogenesis specific basic helix-loop-helix 1) The peptide sequence was selected from the C terminal of SOHLH1. Peptide sequence PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALK
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 402381
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.