Soluble Liver/Pancreas Antigen Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157253

Catalog No. NBP157253

Description

Soluble Liver/Pancreas Antigen Polyclonal specifically detects Soluble Liver/Pancreas Antigen in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Soluble Liver/Pancreas Antigen
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.9.1.2, EC 2.9.1.n1, Liver-pancreas antigen, LPDKFZp434B1417, MGC161491, O-phosphoseryl-tRNA(Sec) selenium transferase, Sec synthase, Selenocysteine synthase, Selenocysteinyl-tRNA(Sec) synthase, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase, SepSecS, Sep-tRNA:Sec-tRNA synthase, SLA/LP, SLA/LP autoantigen, SLA-p35, SLAUGA suppressor tRNA-associated protein, Soluble liver antigen, soluble liver antigen/liver pancreas antigen, tRNA(Ser/Sec)-associated antigenic protein, TRNP48
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51091
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: A1A4F3
• Gene Symbols: SEPSECS
• Immunogen: Synthetic peptides corresponding to SLA/LP(soluble liver antigen/liver pancreas antigen) The peptide sequence was selected from the N terminal of SLA/LP. Peptide sequence MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Human: 100%; Mouse: 100%; Sumatran orangutan: 100%; Western clawed frog: 100%; Canine: 100%; Bovine: 100%; Rat: 100%; Zebrafish: 92%; Chicken: 92%; Green puffer: 92%; Leishmania braziliensis: 84%; Trypanosoma brucei gambiense DAL972: 84%; Blastocystis hominis: 84%; Chlorella variabilis: 84%; Trypanosoma brucei: 84%; Leishmania major: 84%; Leishmania infantum: 84%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG