Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Soluble Liver/Pancreas Antigen Antibody, Novus Biologicals™
SDP

Catalog No. NBP157253 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157253 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157253 Supplier Novus Biologicals Supplier No. NBP157253
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Soluble Liver/Pancreas Antigen Polyclonal specifically detects Soluble Liver/Pancreas Antigen in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Soluble Liver/Pancreas Antigen
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. A1A4F3
Gene Alias EC 2.9.1.2, EC 2.9.1.n1, Liver-pancreas antigen, LPDKFZp434B1417, MGC161491, O-phosphoseryl-tRNA(Sec) selenium transferase, Sec synthase, Selenocysteine synthase, Selenocysteinyl-tRNA(Sec) synthase, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase, SepSecS, Sep-tRNA:Sec-tRNA synthase, SLA/LP, SLA/LP autoantigen, SLA-p35, SLAUGA suppressor tRNA-associated protein, Soluble liver antigen, soluble liver antigen/liver pancreas antigen, tRNA(Ser/Sec)-associated antigenic protein, TRNP48
Gene Symbols SEPSECS
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLA/LP(soluble liver antigen/liver pancreas antigen) The peptide sequence was selected from the N terminal of SLA/LP. Peptide sequence MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51091
Test Specificity Expected identity based on immunogen sequence: Xenopus: 100%; Human: 100%; Mouse: 100%; Sumatran orangutan: 100%; Western clawed frog: 100%; Canine: 100%; Bovine: 100%; Rat: 100%; Zebrafish: 92%; Chicken: 92%; Green puffer: 92%; Leishmania braziliensis: 84%; Trypanosoma brucei gambiense DAL972: 84%; Blastocystis hominis: 84%; Chlorella variabilis: 84%; Trypanosoma brucei: 84%; Leishmania major: 84%; Leishmania infantum: 84%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.