Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Soluble Liver/Pancreas Antigen Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Soluble Liver/Pancreas Antigen |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Soluble Liver/Pancreas Antigen Polyclonal specifically detects Soluble Liver/Pancreas Antigen in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Soluble Liver/Pancreas Antigen | |
Polyclonal | |
Rabbit | |
A1A4F3 | |
51091 | |
Synthetic peptides corresponding to SLA/LP(soluble liver antigen/liver pancreas antigen) The peptide sequence was selected from the N terminal of SLA/LP. Peptide sequence MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
EC 2.9.1.2, EC 2.9.1.n1, Liver-pancreas antigen, LPDKFZp434B1417, MGC161491, O-phosphoseryl-tRNA(Sec) selenium transferase, Sec synthase, Selenocysteine synthase, Selenocysteinyl-tRNA(Sec) synthase, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase, SepSecS, Sep-tRNA:Sec-tRNA synthase, SLA/LP, SLA/LP autoantigen, SLA-p35, SLAUGA suppressor tRNA-associated protein, Soluble liver antigen, soluble liver antigen/liver pancreas antigen, tRNA(Ser/Sec)-associated antigenic protein, TRNP48 | |
SEPSECS | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title