Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Solute carrier family 22 member 18 Antibody, Novus Biologicals™

Solute carrier family 22 member 18 Antibody, Novus Biologicals™
SDP

Catalog No. NBP257503 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP257503 100 μL
NB393928 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP257503 Supplier Novus Biologicals Supplier No. NBP257503
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Solute carrier family 22 member 18 Polyclonal specifically detects Solute carrier family 22 member 18 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Solute carrier family 22 member 18
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Gene Symbols SLC22A18
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5002
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.