Solute carrier family 22 member 18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP257503	Novus Biologicals NBP257503	100 μL
NB393928	Novus Biologicals NBP25750325UL	25 μL

Description

Solute carrier family 22 member 18 Polyclonal specifically detects Solute carrier family 22 member 18 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Solute carrier family 22 member 18
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
• Gene Symbols: SLC22A18
• Isotype: IgG
• Purification Method: Affinity Purified

• Dilution: Immunohistochemistry-Paraffin 1:20 - 1:50
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5002
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only