Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. solute carrier family 22, member 18 antisense Antibody, Novus Biologicals™

solute carrier family 22, member 18 antisense Antibody, Novus Biologicals™
SDP

Catalog No. NB396534 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396534 25 μL
NBP239093 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396534 Supplier Novus Biologicals Supplier No. NBP23909325UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

solute carrier family 22, member 18 antisense Polyclonal specifically detects solute carrier family 22, member 18 antisense in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen solute carrier family 22, member 18 antisense
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8N1D0
Gene Alias BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein
Gene Symbols SLC22A18AS
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5003
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.