solute carrier family 22, member 18 antisense Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP239093

Catalog No. NBP239093

Description

solute carrier family 22, member 18 antisense Polyclonal specifically detects solute carrier family 22, member 18 antisense in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: solute carrier family 22, member 18 antisense
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q8N1D0
• Gene Symbols: SLC22A18AS
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5003
• Target Species: Human
• Isotype: IgG