Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP169270

Sonic Hedgehog/Shh Antibody, Novus Biologicals™
SDP

Catalog No. NBP169270 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169270 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169270 Supplier Novus Biologicals Supplier No. NBP169270
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Sonic Hedgehog/Shh Polyclonal specifically detects Sonic Hedgehog/Shh in Human, Mouse, Chicken samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Sonic Hedgehog/Shh
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q15465
Gene Alias HHG1, HHG-1, HLP3, HPE3, MCOPCB5sonic hedgehog (Drosophila) homolog, SMMCIsonic hedgehog homolog (Drosophila), sonic hedgehog, sonic hedgehog homolog, sonic hedgehog protein, TPT, TPTPS
Gene Symbols SHH
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SHH(sonic hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of SHH (NP_000184). Peptide sequence RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT.
Molecular Weight of Antigen 28 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Neuroscience, Sensory Systems, Stem Cell Signaling Pathway, Stem Cells, Vision
Primary or Secondary Primary
Gene ID (Entrez) 6469
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.