Sonic Hedgehog/Shh Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169270

Catalog No. NBP169270

Description

Sonic Hedgehog/Shh Polyclonal specifically detects Sonic Hedgehog/Shh in Human, Mouse, Chicken samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Sonic Hedgehog/Shh
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HHG1, HHG-1, HLP3, HPE3, MCOPCB5sonic hedgehog (Drosophila) homolog, SMMCIsonic hedgehog homolog (Drosophila), sonic hedgehog, sonic hedgehog homolog, sonic hedgehog protein, TPT, TPTPS
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Research Discipline: Neuroscience, Sensory Systems, Stem Cell Signaling Pathway, Stem Cells, Vision
• Gene ID (Entrez): 6469
• Target Species: Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:1000
• Gene Accession No.: Q15465
• Gene Symbols: SHH
• Immunogen: Synthetic peptides corresponding to SHH(sonic hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of SHH (NP_000184). Peptide sequence RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

For Research Use Only