Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Sonic Hedgehog/Shh Rabbit anti-Human, Mouse, Rat, Clone: 8T4D3, Novus Biologicals™

Sonic Hedgehog/Shh Rabbit anti-Human, Mouse, Rat, Clone: 8T4D3, Novus Biologicals™
SDP

Catalog No. NB166004 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB166004 100 μg
NB166005 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB166004 Supplier Novus Biologicals Supplier No. NBP315454100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Sonic Hedgehog/Shh Monoclonal antibody specifically detects Sonic Hedgehog/Shh in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen Sonic Hedgehog/Shh
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 8T4D3
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias HHG1, HHG-1, HLP3, HPE3, MCOPCB5sonic hedgehog (Drosophila) homolog, SMMCIsonic hedgehog homolog (Drosophila), sonic hedgehog, sonic hedgehog homolog, sonic hedgehog protein, TPT, TPTPS
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog/Shh (Q15465). PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Biologically Active Proteins, Neuroscience, Sensory Systems, Stem Cell Signaling Pathway, Stem Cells, Vision
Primary or Secondary Primary
Gene ID (Entrez) 6469
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.