Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Sortilin Antibody (CL6526), Novus Biologicals™

Sortilin Antibody (CL6526), Novus Biologicals™
SDP

Catalog No. NB392752 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392752 25 μL
NBP276498 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB392752 Supplier Novus Biologicals Supplier No. NBP27649825UL
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Sortilin Monoclonal specifically detects Sortilin in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Sortilin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone CL6526
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence 2-10 ug/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias 100 kDa NT receptor, Glycoprotein 95, Gp95LDLCQ6, Neurotensin receptor 3, NT3NTR3, sortilin, sortilin 1
Gene Symbols SORT1
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6272
Test Specificity Specificity of Sortilin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.