Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Sorting Nexin 32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179591
Description
Sorting Nexin 32 Polyclonal specifically detects Sorting Nexin 32 in Human samples. It is validated for Western Blot.Specifications
Sorting Nexin 32 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp761P1320, FLJ30934, MGC42112, MGC57276, SNX6B, sorting nexin 32, sorting nexin 6B, sorting nexin-32, Sorting nexin-6B | |
Rabbit | |
46 kDa | |
100 μL | |
Primary | |
This product recognizes Human. Predicted Homology Based On Immunogen Sequence: Rabbit: 86%; Guinea pig: 86%; Bovine: 83%; Zebrafish: 79%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_689973 | |
SNX32 | |
Synthetic peptide directed towards the middle region of human FLJ30934. Peptide sequence: SLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS | |
Affinity purified | |
RUO | |
254122 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction