Sorting Nexin 32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179591

Catalog No. NBP179591

Description

Sorting Nexin 32 Polyclonal specifically detects Sorting Nexin 32 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Sorting Nexin 32
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp761P1320, FLJ30934, MGC42112, MGC57276, SNX6B, sorting nexin 32, sorting nexin 6B, sorting nexin-32, Sorting nexin-6B
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product recognizes Human. Predicted Homology Based On Immunogen Sequence: Rabbit: 86%; Guinea pig: 86%; Bovine: 83%; Zebrafish: 79%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_689973
• Gene Symbols: SNX32
• Immunogen: Synthetic peptide directed towards the middle region of human FLJ30934. Peptide sequence: SLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 254122
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.