Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Sorting Nexin 32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Sorting Nexin 32 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Sorting Nexin 32 Polyclonal specifically detects Sorting Nexin 32 in Human samples. It is validated for Western Blot.Specifications
Sorting Nexin 32 | |
Polyclonal | |
Rabbit | |
NP_689973 | |
254122 | |
Synthetic peptide directed towards the middle region of human FLJ30934. Peptide sequence: SLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp761P1320, FLJ30934, MGC42112, MGC57276, SNX6B, sorting nexin 32, sorting nexin 6B, sorting nexin-32, Sorting nexin-6B | |
SNX32 | |
IgG | |
46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title