Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SOX10 Antibody, Novus Biologicals™
SDP

Catalog No. NB168983100 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168983100 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB168983100 Supplier Novus Biologicals Supplier No. NBP168983100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 2 publications

SOX10 Polyclonal specifically detects SOX10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SOX10
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.25 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4.0-8.0 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P56693
Gene Alias MGC15649, PCWH, SRY (sex determining region Y)-box 10, SRY-related HMG-box gene 10, transcription factor SOX-10, WS4C, WS4mouse, human homolog of
Gene Symbols SOX10
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human SOX10 (NP_008872). Peptide sequence PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT.
Molecular Weight of Antigen 50 kDa
Purification Method Affinity Purified
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 6663
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.