Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SOX13 Antibody, Novus Biologicals™

SOX13 Antibody, Novus Biologicals™
SDP

Catalog No. NBP258396 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP258396 100 μL
NB393470 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP258396 Supplier Novus Biologicals Supplier No. NBP258396
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SOX13 Polyclonal specifically detects SOX13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen SOX13
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Islet cell antigen 12, MGC117216, Sox-13, SRY (sex determining region Y)-box 13ICA12islet cell 12, SRY-box 13, SRY-related HMG-box gene 13, transcription factor SOX-13, Type 1 diabetes autoantigen ICA12
Gene Symbols SOX13
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRNSSHI
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Diabetes Research, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 9580
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.