Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SOX2 Antibody (CL4716), Novus Biologicals™
SDP

Catalog No. NBP259057 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP259057 100 μL
NB393146 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP259057 Supplier Novus Biologicals Supplier No. NBP259057
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

SOX2 Monoclonal specifically detects SOX2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen SOX2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias ANOP3, MCOPS3, MGC2413, SRY (sex determining region Y)-box 2, SRY-related HMG-box gene 2, transcription factor SOX2, transcription factor SOX-2
Gene Symbols SOX2
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Core ESC Like Genes, Embryonic Stem Cell Markers, Neuronal Stem Cell Markers, Neuroscience, Sensory Systems, Stem Cell Markers, Stem Cells, Transcription Factors and Regulators, Vision
Primary or Secondary Primary
Gene ID (Entrez) 6657
Test Specificity Specificity of human SOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.