SOX3 Antibody (CL4725), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP259060

Catalog No. NBP259060

Description

SOX3 Monoclonal specifically detects SOX3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SOX3
• Classification: Monoclonal
• Dilution: Western Blot 1 ug/ml
• Gene Alias: GHDX, MRGH, panhypopituitarism, PHP, PHPX, SOXB, SRY (sex determining region Y)-box 3, transcription factor SOX-3
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6658
• Target Species: Human, Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SOX3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGLFTVAAPAPGAPSPPATLAHLLPAPAMYSLLETELKNPVGTPTQAAGTGGPAAPGGAGKSSA
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

For Research Use Only