Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP185551

SOX9 Antibody, Novus Biologicals™
SDP

Catalog No. NBP185551 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP185551 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP185551 Supplier Novus Biologicals Supplier No. NBP185551
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 17 publications

SOX9 Polyclonal specifically detects SOX9 in Human, Mouse, Rat, Porcine, Canine samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Gel Supershift Assay, Knockdown Validated.

Specifications

Antigen SOX9
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Gel Shift, KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Simple Western, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen -Reported in scientific literature (PMID:32103177)., Gel Supershift Assay -Reported in scientific literature (PMID: 26430891)., Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P48436
Gene Alias campomelic dysplasia, autosomal sex-reversal, CMD 1, CMD1, CMPD1, SRA1SRY (sex-determining region Y)-box 9 protein, SRY (sex determining region Y)-box 9, SRY-related HMG-box, gene 9, transcription factor SOX-9
Gene Symbols SOX9
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Neuronal Stem Cell Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6662
Test Specificity Specificity of human SOX9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat, Pig, Canine
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.