Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SOX9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 17 publications
Supplier: Novus Biologicals NBP185551
Description
SOX9 Polyclonal specifically detects SOX9 in Human, Mouse, Rat, Porcine, Canine samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Gel Supershift Assay, Knockdown Validated.Specifications
SOX9 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Simple Western, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen -Reported in scientific literature (PMID:32103177)., Gel Supershift Assay -Reported in scientific literature (PMID: 26430891)., Knockdown Validated | |
P48436 | |
SOX9 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR | |
0.1 mL | |
Cancer, Neuronal Stem Cell Markers, Stem Cell Markers | |
6662 | |
Human, Mouse, Rat, Pig, Canine | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Gel Shift, KnockDown | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
campomelic dysplasia, autosomal sex-reversal, CMD 1, CMD1, CMPD1, SRA1SRY (sex-determining region Y)-box 9 protein, SRY (sex determining region Y)-box 9, SRY-related HMG-box, gene 9, transcription factor SOX-9 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human SOX9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction