SP-B/Surfactant Protein B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP157977

Catalog No. NBP157977

Description

SP-B/Surfactant Protein B Polyclonal specifically detects SP-B/Surfactant Protein B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SP-B/Surfactant Protein B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 18 kDa pulmonary-surfactant protein, 6 kDa protein, PSP-B, pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SFTB3, SFTP3, SMDP1, SP-B surfactant, pulmonary-associated protein B, surfactant protein B
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6439
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: B2RC55
• Gene Symbols: SFTPB
• Immunogen: Synthetic peptides corresponding to SFTPB(surfactant, pulmonary-associated protein B) The peptide sequence was selected from the middle region of SFTPB. Peptide sequence PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Rat: 100%; Mouse: 92%; Pig: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

For Research Use Only