Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SP-B/Surfactant Protein B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
Supplier: Novus Biologicals NBP157977
Description
SP-B/Surfactant Protein B Polyclonal specifically detects SP-B/Surfactant Protein B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SP-B/Surfactant Protein B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
18 kDa pulmonary-surfactant protein, 6 kDa protein, PSP-B, pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SFTB3, SFTP3, SMDP1, SP-B surfactant, pulmonary-associated protein B, surfactant protein B | |
Rabbit | |
Affinity purified | |
RUO | |
6439 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
B2RC55 | |
SFTPB | |
Synthetic peptides corresponding to SFTPB(surfactant, pulmonary-associated protein B) The peptide sequence was selected from the middle region of SFTPB. Peptide sequence PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Rat: 100%; Mouse: 92%; Pig: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction