SP-D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238803

Catalog No. NBP238803

Description

SP-D Polyclonal specifically detects SP-D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SP-D
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: P35247
• Gene Symbols: SFTPD
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 6441
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: COLEC7collectin-7, collectin 7, Collectin-7, Lung surfactant protein D, PSPD, PSP-D, SFTP4pulmonary surfactant-associated protein D, SP-Dpulmonary surfactant apoprotein, surfactant protein D, surfactant, pulmonary-associated protein D, surfactant-associated protein, pulmonary 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.