Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SP-D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | SP-D |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SP-D Polyclonal specifically detects SP-D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SP-D | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| COLEC7collectin-7, collectin 7, Collectin-7, Lung surfactant protein D, PSPD, PSP-D, SFTP4pulmonary surfactant-associated protein D, SP-Dpulmonary surfactant apoprotein, surfactant protein D, surfactant, pulmonary-associated protein D, surfactant-associated protein, pulmonary 4 | |
| SFTPD | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P35247 | |
| 6441 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title