SPACA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18913625UL

Catalog No. NB430898

Description

SPACA3 Polyclonal specifically detects SPACA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SPACA3
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: CT54ALLP17Cancer/testis antigen 54, LYC3Sperm protein reactive with ASA, Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17, Lysozyme-like protein 3, lysozyme-like sperm-specific secretory protein ALLP17, LYZL31700025M08Rik, SLLP1MGC119058, sperm acrosome associated 3, sperm acrosome membrane-associated protein 3, sperm lysozyme like protein 1, Sperm lysozyme-like protein 1, Sperm protein reactive with antisperm antibodies, SPRASA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 124912
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SPACA3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only