SPACA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB430898	Novus Biologicals NBP18913625UL	25 μL
NBP189136	Novus Biologicals NBP189136	0.1 mL

Description

SPACA3 Polyclonal specifically detects SPACA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SPACA3
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CT54ALLP17Cancer/testis antigen 54, LYC3Sperm protein reactive with ASA, Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17, Lysozyme-like protein 3, lysozyme-like sperm-specific secretory protein ALLP17, LYZL31700025M08Rik, SLLP1MGC119058, sperm acrosome associated 3, sperm acrosome membrane-associated protein 3, sperm lysozyme like protein 1, Sperm lysozyme-like protein 1, Sperm protein reactive with antisperm antibodies, SPRASA
• Gene Symbols: SPACA3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 124912
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only