Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | SPATA2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17973620
![]() |
Novus Biologicals
NBP17973620UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179736
![]() |
Novus Biologicals
NBP179736 |
100 μL |
Each for $487.50
|
|
|||||
Description
SPATA2 Polyclonal specifically detects SPATA2 in Human samples. It is validated for Western Blot.Specifications
SPATA2 | |
Polyclonal | |
Rabbit | |
NP_001129245 | |
9825 | |
Synthetic peptide directed towards the C terminal of human SPATA2The immunogen for this antibody is SPATA2. Peptide sequence DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA0757FLJ13167, PD1spermatogenesis associated PD1, spermatogenesis associated 2, spermatogenesis-associated protein 2, Spermatogenesis-associated protein PD1, tamo | |
SPATA2 | |
IgG | |
58 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title