Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17973620UL
Description
SPATA2 Polyclonal specifically detects SPATA2 in Human samples. It is validated for Western Blot.Specifications
SPATA2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001129245 | |
SPATA2 | |
Synthetic peptide directed towards the C terminal of human SPATA2The immunogen for this antibody is SPATA2. Peptide sequence DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD. | |
Affinity Purified | |
RUO | |
9825 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KIAA0757FLJ13167, PD1spermatogenesis associated PD1, spermatogenesis associated 2, spermatogenesis-associated protein 2, Spermatogenesis-associated protein PD1, tamo | |
Rabbit | |
58 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction