Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SPATA2 Antibody, Novus Biologicals™

SPATA2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17973620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17973620 20 μL
NBP179736 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17973620 Supplier Novus Biologicals Supplier No. NBP17973620UL

Description

Rabbit Polyclonal Antibody

SPATA2 Polyclonal specifically detects SPATA2 in Human samples. It is validated for Western Blot.

Specifications

Antigen SPATA2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001129245
Gene Alias KIAA0757FLJ13167, PD1spermatogenesis associated PD1, spermatogenesis associated 2, spermatogenesis-associated protein 2, Spermatogenesis-associated protein PD1, tamo
Gene Symbols SPATA2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human SPATA2The immunogen for this antibody is SPATA2. Peptide sequence DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD.
Molecular Weight of Antigen 58 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9825
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.