Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                SPATA2 Antibody, Novus Biologicals™
 
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | SPATA2 | 
|---|---|
| Applications | Western Blot | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
| Host Species | Rabbit | 
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP17973620  | Novus Biologicals NBP17973620UL | 20 μL | 
                                        
                                            
                                                
                                                
                                                
                                            
                                        
                                        
                                            
                                            
                                                
                                                
                                            
                                        
                                        
                                            
                                                
                                                Each for $206.00
                                                 |  | |||||
| NBP179736  | Novus Biologicals NBP179736 | 100 μL | 
                                        
                                            
                                                
                                                
                                                
                                            
                                        
                                        
                                            
                                            
                                                
                                                
                                            
                                        
                                        
                                            
                                                
                                                Each for $487.50
                                                 |  | |||||
Description
SPATA2 Polyclonal specifically detects SPATA2 in Human samples. It is validated for Western Blot.Specifications
| SPATA2 | |
| Polyclonal | |
| Rabbit | |
| NP_001129245 | |
| 9825 | |
| Synthetic peptide directed towards the C terminal of human SPATA2The immunogen for this antibody is SPATA2. Peptide sequence DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD. | |
| Primary | 
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA0757FLJ13167, PD1spermatogenesis associated PD1, spermatogenesis associated 2, spermatogenesis-associated protein 2, Spermatogenesis-associated protein PD1, tamo | |
| SPATA2 | |
| IgG | |
| 58 kDa | 
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            