Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPATA2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SPATA2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17973620
View Documents
Novus Biologicals
NBP17973620UL
20 μL
Each for $152.22
Add to cart
 
NBP179736
View Documents
Novus Biologicals
NBP179736
100 μL
Each for $436.00
Add to cart
 
Description

Description

SPATA2 Polyclonal specifically detects SPATA2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SPATA2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
KIAA0757FLJ13167, PD1spermatogenesis associated PD1, spermatogenesis associated 2, spermatogenesis-associated protein 2, Spermatogenesis-associated protein PD1, tamo
SPATA2
IgG
Affinity Purified
58 kDa
Western Blot
Unconjugated
RUO
NP_001129245
9825
Synthetic peptide directed towards the C terminal of human SPATA2The immunogen for this antibody is SPATA2. Peptide sequence DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit