SPATA7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156884

Catalog No. NBP156884

Description

SPATA7 Polyclonal specifically detects SPATA7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SPATA7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HSD-3.1, HSD3DKFZp686D07199, LCA3, Leber congenital amaurosis 3, MGC102934, spermatogenesis associated 7, spermatogenesis-associated protein 7, Spermatogenesis-associated protein HSD3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55812
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9P0W8
• Gene Symbols: SPATA7
• Immunogen: Synthetic peptides corresponding to SPATA7(spermatogenesis associated 7) The peptide sequence was selected from the middle region of SPATA7. Peptide sequence FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Pig: 100%; Bovine: 92%; Guinea pig: 92%; Mouse: 92%; Canine: 85%; Rat: 85%; Rabbit: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG