Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPC18 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125263 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125263 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125263 Supplier Novus Biologicals Supplier No. NBP310181100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SPC18 Polyclonal specifically detects SPC18 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen SPC18
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias EC 3.4, Endopeptidase SP18, Microsomal signal peptidase 18 kDa subunit, SEC11 homolog A, SEC11 homolog A (S. cerevisiae), SEC11L1, SEC11-like 1, SEC11-like protein 1, sid2895, signal peptidase complex (18kD), signal peptidase complex catalytic subunit SEC11A, SPase 18 kDa subunit, SPC18SEC11-like 1 (S. cerevisiae), SPCS4A1810012E07Rik
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse SPC18 (NP_064335.1). Peptide sequence EIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23478
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.