SPECC1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24964025UL

Catalog No. NB395580

Description

SPECC1L Polyclonal antibody specifically detects SPECC1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SPECC1L
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Cytokinesis And Spindle Organization A, Cytospin A, CYTSA, GBBB2, KIAA0376, OBLFC1, Renal Carcinoma Antigen NY-REN-22, SPECC1-Like, SPECC1-Like Protein, Sperm Antigen With Calponin Homology And Coiled-Coil Domains 1-Like
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cell Biology, Cell Cycle and Replication, Immunology
• Gene ID (Entrez): 23384
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified