Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SPECC1L Antibody, Novus Biologicals™

SPECC1L Antibody, Novus Biologicals™
SDP

Catalog No. NB395580 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395580 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395580 Supplier Novus Biologicals Supplier No. NBP24964025UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SPECC1L Polyclonal antibody specifically detects SPECC1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen SPECC1L
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias Cytokinesis And Spindle Organization A, Cytospin A, CYTSA, GBBB2, KIAA0376, OBLFC1, Renal Carcinoma Antigen NY-REN-22, SPECC1-Like, SPECC1-Like Protein, Sperm Antigen With Calponin Homology And Coiled-Coil Domains 1-Like
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cell Biology, Cell Cycle and Replication, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 23384
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.