Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPECC1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | SPECC1L |
---|---|
Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SPECC1L Polyclonal antibody specifically detects SPECC1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
SPECC1L | |
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Apoptosis, Cell Biology, Cell Cycle and Replication, Immunology | |
PBS (pH 7.2), 40% Glycerol | |
23384 | |
IgG | |
Immunogen affinity purified |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
Cytokinesis And Spindle Organization A, Cytospin A, CYTSA, GBBB2, KIAA0376, OBLFC1, Renal Carcinoma Antigen NY-REN-22, SPECC1-Like, SPECC1-Like Protein, Sperm Antigen With Calponin Homology And Coiled-Coil Domains 1-Like | |
This antibody was developed against a recombinant protein corresponding to amino acids: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title