Speedy/Ringo Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25518325UL

Catalog No. NB404020

Description

Speedy/Ringo Polyclonal specifically detects Speedy/Ringo in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Speedy/Ringo
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: hSpy/Ringo A, MGC110856, Rapid inducer of G2/M progression in oocytes A, RINGO A, Ringo3, SPDY1, speedy homolog 1 (Drosophila), speedy homolog A (Xenopus laevis), speedy protein A, speedy-1, Spy1, SPY1MGC57218
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SPDYA
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS
• Quantity: 25 μL
• Research Discipline: Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair
• Gene ID (Entrez): 245711
• Target Species: Human
• Isotype: IgG

For Research Use Only