Sperm Flagellar 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238461

Catalog No. NBP238461

Description

Sperm Flagellar 2 Polyclonal specifically detects Sperm Flagellar 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Sperm Flagellar 2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: Q9C093
• Gene Symbols: SPEF2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYEKDPPQLDYTQMLLYFACHPDTVEGVYRALSVAVGTHVFQQVKA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: cancer/testis antigen 122, CT122, FLJ23164, FLJ23577, FLJ25395, KIAA1770, KPL2MGC102842, Protein KPL2, sperm flagellar 2, sperm flagellar protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79925
• Target Species: Human
• Isotype: IgG