Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SPICE1 Antibody, Novus Biologicals™

SPICE1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP170720UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP170720UL 20 μL
NBP170711 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP170720UL Supplier Novus Biologicals Supplier No. NBP17071120UL

Description

Rabbit Polyclonal Antibody

SPICE1 Polyclonal specifically detects SPICE1 in Human samples. It is validated for Western Blot.

Specifications

Antigen SPICE1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias CCDC52, FLJ26064, SPICE, spindle and centriole associated protein 1
Gene Symbols SPICE1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CCDC52(coiled-coil domain containing 52) The peptide sequence was selected from the N terminal of CCDC52. Peptide sequence TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 152185
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.