Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPICE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	SPICE1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP170720UL View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17071120UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP170711 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP170711	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SPICE1 Polyclonal specifically detects SPICE1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	SPICE1
Classification	Polyclonal
Host Species	Rabbit
Gene Alias	CCDC52, FLJ26064, SPICE, spindle and centriole associated protein 1
Gene Symbols	SPICE1
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	152185
Immunogen	Synthetic peptides corresponding to CCDC52(coiled-coil domain containing 52) The peptide sequence was selected from the N terminal of CCDC52. Peptide sequence TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SPICE1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents