Splicing factor, arginine/serine-rich 11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157324

Catalog No. NBP157324

Description

Splicing factor, arginine/serine-rich 11 Polyclonal specifically detects Splicing factor, arginine/serine-rich 11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Splicing factor, arginine/serine-rich 11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Arginine-rich 54 kDa nuclear protein, dJ677H15.2, DKFZp686M13204, p54NET2, serine/arginine-rich splicing factor 11, SFRS11, splicing factor p54, Splicing factor, arginine/serine-rich 11FLJ18226, SR splicing factor 11
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9295
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q05519
• Gene Symbols: SRSF11
• Immunogen: Synthetic peptides corresponding to SFRS11(splicing factor, arginine/serine-rich 11) The peptide sequence was selected from the C terminal of SFRS11. Peptide sequence KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Human: 100%; Mouse: 92%; Rat: 92%; Bovine: 92%; Pig: 92%;.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine
• Isotype: IgG