SPPL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157070

Catalog No. NBP157070

Description

SPPL3 Polyclonal specifically detects SPPL3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SPPL3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp586C1324, EC 3.4.23.-, IMP-2, IMP2MGC126674, Intramembrane protease 2, MDHV1887, MGC126676, MGC90402, Presenilin-like protein 4, PRO4332, PSL4, signal peptide peptidase 3, signal peptide peptidase-like 3, SPP-like 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 121665
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q3MJ04
• Gene Symbols: SPPL3
• Immunogen: Synthetic peptides corresponding to UNQ1887 (signal peptide peptidase 3) The peptide sequence was selected from the middle region of UNQ1887. Peptide sequence VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.