SPPL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232505

Catalog No. NBP232505

Description

SPPL3 Polyclonal specifically detects SPPL3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SPPL3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: DKFZp586C1324, EC 3.4.23.-, IMP-2, IMP2MGC126674, Intramembrane protease 2, MDHV1887, MGC126676, MGC90402, Presenilin-like protein 4, PRO4332, PSL4, signal peptide peptidase 3, signal peptide peptidase-like 3, SPP-like 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 121665
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SPPL3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLRYDNYKKQASGDSCGAPGPANISGRMQKVSY
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only