Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPSB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$499.50

Specifications

Antigen	SPSB2
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP174266 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP174266	100 μL	Each of 1 for $499.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

SPSB2 Polyclonal specifically detects SPSB2 in Human, Monkey samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen	SPSB2
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q99619
Gene ID (Entrez)	84727
Immunogen	Synthetic peptides corresponding to the C terminal of SPSB2. Immunizing peptide sequence IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG.
Primary or Secondary	Primary

Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Signal Transduction
Gene Alias	FLJ17395, Gene-rich cluster protein C9, GRCC9MGC2519, splA/ryanodine receptor domain and SOCS box containing 2, SPRY domain-containing SOCS box protein SSB-2, SSB-2, SSB2SPRY domain-containing SOCS box protein 2
Gene Symbols	SPSB2
Isotype	IgG
Molecular Weight of Antigen	28 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SPSB2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents