SPTLC3 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP233418	0.1 mL
NB397431	25 μL

Catalog No. NBP233418 Supplier Novus Biologicals Supplier No. NBP233418

Description

Rabbit Polyclonal Antibody

SPTLC3 Polyclonal specifically detects SPTLC3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SPTLC3
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: Q9NUV7
• Gene Alias: C20orf38, Chromosome 20 Open Reading Frame 38, dJ718P11, EC 2.3.1.50, hLCB2b, LCB 3, LCB2B, LCB3, Long Chain Base Biosynthesis Protein 2b, Long Chain Base Biosynthesis Protein 3, Serine Palmitoyltransferase 3, Serine Palmitoyltransferase, Long Chain Base Subunit 2-Like (Aminotransferase 2), Serine Palmitoyltransferase, Long Chain Base Subunit 3, Serine-Palmitoyl-CoA Transferase 3, SPT 3, SPT3, SPTLC2L
• Gene Symbols: SPTLC3
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 55304
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only