Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SR-BI Antibody, Novus Biologicals™
SDP

Catalog No. NB393051 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393051 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB393051 Supplier Novus Biologicals Supplier No. NBP26267625UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SR-BI Polyclonal antibody specifically detects SR-BI in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen SR-BI
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias CD36 and LIMPII analogous 1, CD36 antigen, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1, CD36L1scavenger receptor class B type 1, CLA1 CD36 antigen-like 1, CLA-1 HDLQTL6, Collagen type I receptor, thrombospondin receptor-like 1, MGC138242, SCARB1, scavenger receptor class B type III, scavenger receptor class B, member 1, SR-B1, SRB1 scavenger receptor class B member 1, SRBI
Host Species Rabbit
Immunogen This SR-BI Antibody was developed against a recombinant protein corresponding to amino acids: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cardiovascular Biology, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction, Virology Bacteria and Parasites
Primary or Secondary Primary
Gene ID (Entrez) 949
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.