Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SR-BI Antibody, Novus Biologicals™

SR-BI Antibody, Novus Biologicals™
SDP

Catalog No. NBP254750 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP254750 100 μL
NB404087 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP254750 Supplier Novus Biologicals Supplier No. NBP254750
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SR-BI Polyclonal specifically detects SR-BI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen SR-BI/SR-BII
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias CD36 and LIMPII analogous 1, CD36 antigen, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1, CD36L1scavenger receptor class B type 1, CLA1CD36 antigen-like 1, CLA-1HDLQTL6, Collagen type I receptor, thrombospondin receptor-like 1, scavenger receptor class B type III, scavenger receptor class B, member 1, SRB1scavenger receptor class B member 1, SR-BIMGC138242
Gene Symbols SCARB1
Host Species Rabbit
Immunogen This SR-BI Antibody was developed against a Recombinant Protein corresponding to amino acids: PRSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGA
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cardiovascular Biology, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction, Virology Bacteria and Parasites
Primary or Secondary Primary
Gene ID (Entrez) 949
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.