SRA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24881625UL

Catalog No. NB395980

Description

SRA1 Polyclonal antibody specifically detects SRA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SRA1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: MGC87674, pp7684, SRA, SRAP, steriod receptor RNA activator 1, steriod receptor RNA activator protein, steroid receptor coactivator, steroid receptor RNA activator 1, steroid receptor RNA activator 1 (complexes with NCOA1), Steroid receptor RNA activator protein, STRAA1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGP
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Cardiovascular Biology, Cell Biology, Endocrinology, Signal Transduction
• Gene ID (Entrez): 10011
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified