Novus Biologicals™ SRC1 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRC1. Source: E.coli Amino Acid Sequence: NLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPAS The SRC1 Recombinant Protein Antigen is derived from E. coli. The SRC1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 8648
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: SRC1 Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: bHLHe42, BHLHE74, Class E basic helix-loop-helix protein 74, EC 2.3.1.48, Hin-2 protein, KAT13A, MGC129719, NCoA-1, nuclear receptor coactivator 1, PAX3/NCOA1 fusion protein, Protein Hin-2, Renal carcinoma antigen NY-REN-52, RIP160bHLHe74F-SRC-1, SRC-1, S
• Gene Symbol: NCOA1
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53201. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only