Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SRCRB4D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	SRCRB4D
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP237994 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP237994	0.1 mL	Each for $610.00	Only null left	Sign In or Register to check your price. Add to Cart

NB397010 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23799425UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

SRCRB4D Polyclonal specifically detects SRCRB4D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	SRCRB4D
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	S4D-SRCRB, S4-SRCRB, scavenger receptor cysteine rich domain containing, group B (4 domains), scavenger receptor cysteine-rich domain-containing group B protein, scavenger receptor cysteine-rich protein SRCRB-S4D, SRCRB-S4D, SSC4D
Gene Symbols	SSC4D
Isotype	IgG
Purification Method	Affinity Purified

Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q8WTU2
Gene ID (Entrez)	136853
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SRCRB4D Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents